PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g19610.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-PHD
Protein Properties Length: 1002aa    MW: 109866 Da    PI: 4.6241
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g19610.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox391.4e-12811863456
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       R++f +   ++L e+F+ ++yp+++ +e LA++lgLt +qV+ WF  rR+k +
  Bradi2g19610.6.p 811 RRQFGPIIYQRLHEHFKTDQYPKRAVKESLANELGLTFQQVSKWFETRRYKTR 863
                       7778888889*****************************************87 PP

2PHD39.99.9e-14253308151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C++   + +++++lCdg C++ fH+kCl+++l ++++p g   wlC+ C++k
  Bradi2g19610.6.p 253 ICATCSSqyVTLNNDIILCDGvCDRGFHQKCLNPPLLTKDIPAGdeGWLCPACDCK 308
                       6******87667********77********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.4E-12247311IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.105.8E-12250307IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.923251308IPR019787Zinc finger, PHD-finger
SMARTSM002492.0E-10253306IPR001965Zinc finger, PHD-type
PfamPF006281.2E-10253308IPR019787Zinc finger, PHD-finger
CDDcd155041.07E-23254305No hitNo description
PROSITE patternPS013590254305IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007114.107805865IPR001356Homeobox domain
SMARTSM003894.3E-10807869IPR001356Homeobox domain
CDDcd000862.61E-11810863No hitNo description
SuperFamilySSF466898.55E-12810870IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-12811870IPR009057Homeodomain-like
PfamPF000464.8E-10811863IPR001356Homeobox domain
PROSITE patternPS000270840863IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1002 aa     Download sequence    Send to blast
MDMNKGTGSG CAEDNVETGN YANSSQNPET LDNQSLPYTS QSLENNTGQR KNYKRTANRG  60
RKGYRVLADR NYPLRSSDCD TTVRVLRSRS AANKPPSDSA HTLVHSAANK FPSDSVHTLV  120
QPAAKRIKRG RPTKKGPNNE FSKIRQRVRY ILNRMNYEQS LLEAYANEGW KRQSCDFLVV  180
LSCDVKMLVT NTQTYSLEKI RPEKELERAK EEIVRCKLRI REAFQNLDSL LSMGKLDESL  240
FDNEGKISCE DIICATCSSQ YVTLNNDIIL CDGVCDRGFH QKCLNPPLLT KDIPAGDEGW  300
LCPACDCKID CIDVINELQG TNLSISDSWE KVFPETAALA HGTIPKDAFD LPSEDSEDSD  360
FDPNIAEEHV TGHEEGSSEE DEDEGSDSDD SNFVTTCDNS EHLKEKEKVD DLGLPSEDSE  420
DDDYDPAGPD SDKDIKEKQD ESDFTSDSDD FCAEIAKSCG RDEVSSGAKV GDPTNDLEGA  480
TACSNTAIPN LTSNDLEIDQ DEVLPVLGRR QGQRLDYKKL YDDAYGEAPS DSSDGEEWSG  540
KSTSEKGDEE RNEVDSFLRK SSRGTGTVQQ SNDFLPQSAR QSLDPDGLVN GQHPGKLTSD  600
VSNNKTNRKP LNNKEEVDDL GLPSEDSEDD DYDPAGPDSD KDIEKKQSSS NESDYSSASD  660
DFCGEIAKSC GREGVPSGAK AGGHPTNDLE GTTVRTNAAI SNLPSKDSQM DQDVVSPVSG  720
RRQDQSLDCK KLYDEACREA SSDSSDGEDW SGKCTPEKDS EKQSDTCRRT GAVRQSNGST  780
PDNARQSLHR TNGQHTEELL TSDGSSSTVH RRQFGPIIYQ RLHEHFKTDQ YPKRAVKESL  840
ANELGLTFQQ VSKWFETRRY KTRIAAKKND SCVKNHSIKE NQSSVAAHIE ATDPKDLGKK  900
LNVCKNGAAN DVMASGILNG GIKQDSPLKQ DTSGGLGTHV SPPGSSPKGD PIENHGNNTS  960
SRCVGKPKDG YTGNVVLALP VVDDRTKEAA MRELKKRKTG S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231157.10.0PREDICTED: homeobox protein HOX1A-like isoform X1
RefseqXP_014754573.10.0PREDICTED: homeobox protein HOX1A-like isoform X1
SwissprotP466050.0HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLI1HHJ20.0I1HHJ2_BRADI; Uncharacterized protein
STRINGBRADI2G19610.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Representative plantOGRP18301539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.13e-73Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain